DAZ4 antibody (Middle Region)
-
- Target See all DAZ4 Antibodies
- DAZ4 (Deleted In Azoospermia 4 (DAZ4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DAZ4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DAZ4 antibody was raised against the middle region of DAZ4
- Purification
- Affinity purified
- Immunogen
- DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA
- Top Product
- Discover our top product DAZ4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAZ4 Blocking Peptide, catalog no. 33R-4176, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZ4 (Deleted In Azoospermia 4 (DAZ4))
- Alternative Name
- DAZ4 (DAZ4 Products)
- Synonyms
- pDP1680 antibody, pDP1681 antibody, DAZ4 antibody, deleted in azoospermia 4 antibody, DAZ4 antibody
- Background
- This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
- Molecular Weight
- 44 kDa (MW of target protein)
-