ERAL1 antibody

Catalog No. ABIN633479

Product Details anti-ERAL1 Antibody

Target: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERAL1 Blocking Peptide, catalog no. 33R-4708, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERAL1

Target: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Alternative Name: ERAL1 (ERAL1 Products)

Synonyms: ERAL1 antibody, 2610524P08Rik antibody, 9130407C09Rik antibody, AU019798 antibody, Era antibody, M-ERA antibody, MERA-S antibody, MERA-W antibody, GdERA antibody, si:ch211-207c6.1 antibody, ERA antibody, ERAL1A antibody, H-ERA antibody, HERA-A antibody, HERA-B antibody, eral1 antibody, Era like 12S mitochondrial rRNA chaperone 1 antibody, Era (G-protein)-like 1 (E. coli) antibody, Era-like 12S mitochondrial rRNA chaperone 1 antibody, Era-like 12S mitochondrial rRNA chaperone 1 L homeolog antibody, GTP-binding protein era homolog antibody, ERAL1 antibody, Eral1 antibody, eral1 antibody, eral1.L antibody, eral antibody

Background: ERAL1 belongs to the era/mnmE GTP-binding protein family.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly