KLHL23 antibody

Catalog No. ABIN633495

Product Details anti-KLHL23 Antibody

Target: KLHL23 (Kelch-Like 23 (KLHL23))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL23 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL23 Blocking Peptide, catalog no. 33R-9387, is also available for use as a blocking control in assays to test for specificity of this KLHL23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL23

Target: KLHL23 (Kelch-Like 23 (KLHL23))

Alternative Name: KLHL23 (KLHL23 Products)

Synonyms: DITHP antibody, C130068N17Rik antibody, RGD1307166 antibody, Klhl23 antibody, kelch like family member 23 antibody, kelch-like 23 antibody, kelch-like family member 23 antibody, kelch-like protein 23 antibody, kelch-like 23 (Drosophila) antibody, KLHL23 antibody, Klhl23 antibody, LOC488392 antibody, LOC100731969 antibody

Background: This protein mediates protein binding.

Molecular Weight: 64 kDa (MW of target protein)