-
- Target
- CTA-126B4.3
- Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- CTA-126 B4.3 antibody was raised against the N terminal of CTA-126 4.3
- Purification
- Affinity purified
- Immunogen
- CTA-126 B4.3 antibody was raised using the N terminal of CTA-126 4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP
-
anti-CTA-126B4.3 (N-Term) antibody
Reactivity: Human, Mouse, Pig, Rabbit, Cow, Rat, Dog, Guinea Pig, Horse WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CTA-126B4.3 Blocking Peptide, catalog no. 33R-6923, is also available for use as a blocking control in assays to test for specificity of this CTA-126B4.3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTA-120 4.3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTA-126B4.3
- Background
- The function of CTA-126B4.3 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 32 kDa (MW of target protein)
-
You are here:
