ZCRB1 antibody (N-Term)
-
- Target See all ZCRB1 Antibodies
- ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZCRB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZCRB1 antibody was raised against the N terminal of ZCRB1
- Purification
- Affinity purified
- Immunogen
- ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
- Top Product
- Discover our top product ZCRB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZCRB1 Blocking Peptide, catalog no. 33R-6428, is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCRB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))
- Alternative Name
- ZCRB1 (ZCRB1 Products)
- Synonyms
- MADP-1 antibody, madp1 antibody, rbm36 antibody, madp-1 antibody, zcchc19 antibody, MADP1 antibody, RBM36 antibody, SNRNP31 antibody, ZCCHC19 antibody, 2700088M22Rik antibody, Madp-1 antibody, RGD1309851 antibody, si:ch211-155a11.4 antibody, zgc:110711 antibody, zinc finger CCHC-type and RNA binding motif containing 1 antibody, zinc finger CCHC-type and RNA binding motif 1 antibody, zinc finger CCHC-type and RNA binding motif containing 1 L homeolog antibody, ZCRB1 antibody, zcrb1 antibody, Zcrb1 antibody, zcrb1.L antibody
- Background
- Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.
- Molecular Weight
- 24 kDa (MW of target protein)
-