Splicing Factor 4 antibody (Middle Region)
-
- Target See all Splicing Factor 4 (SF4) Antibodies
- Splicing Factor 4 (SF4)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Splicing Factor 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SF4 antibody was raised against the middle region of SF4
- Purification
- Affinity purified
- Immunogen
- SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK
- Top Product
- Discover our top product SF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SF4 Blocking Peptide, catalog no. 33R-9065, is also available for use as a blocking control in assays to test for specificity of this SF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Splicing Factor 4 (SF4)
- Alternative Name
- SF4 (SF4 Products)
- Synonyms
- SF4 antibody, rbp antibody, f23858 antibody, F23858 antibody, RBP antibody, 5730496N02Rik antibody, Sf4 antibody, sf4 antibody, SURP and G-patch domain containing 1 antibody, SURP and G patch domain containing 1 antibody, SURP and G-patch domain containing 1 S homeolog antibody, SUGP1 antibody, sugp1 antibody, Sugp1 antibody, sugp1.S antibody
- Background
- SF4 is a member of the SURP family of splicing factors. SF4 is a member of the SURP family of splicing factors.
- Molecular Weight
- 72 kDa (MW of target protein)
-