PCBP1 antibody

Catalog No. ABIN633568

Product Details anti-PCBP1 Antibody

Target: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCBP1 Blocking Peptide, catalog no. 33R-7142, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCBP1

Target: PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))

Alternative Name: PCBP1 (PCBP1 Products)

Synonyms: PCBP1 antibody, HNRPE1 antibody, HNRPX antibody, hnRNP-E1 antibody, hnRNP-X antibody, hnRNP E1 antibody, WBP17 antibody, [a]CP-1 antibody, alphaCP-1 antibody, RGD1561319 antibody, poly(rC) binding protein 1 antibody, poly(rC) binding protein 1 L homeolog antibody, poly(rC)-binding protein 1 antibody, PCBP1 antibody, pcbp1.L antibody, LOC100388387 antibody, Pcbp1 antibody

Background: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure.

Molecular Weight: 37 kDa (MW of target protein)