ALKBH8 antibody
-
- Target See all ALKBH8 Antibodies
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALKBH8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG
- Top Product
- Discover our top product ALKBH8 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALKBH8 Blocking Peptide, catalog no. 33R-5870, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
- Alternative Name
- ALKBH8 (ALKBH8 Products)
- Synonyms
- ABH8 antibody, 4930562C03Rik antibody, 8030431D03Rik antibody, 9430088N01Rik antibody, Abh8 antibody, alkB homolog 8, tRNA methyltransferase antibody, ALKBH8 antibody, Alkbh8 antibody
- Background
- ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA and catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA.
- Molecular Weight
- 27 kDa (MW of target protein)
-