ALKBH8 antibody

Catalog No. ABIN633582

Product Details anti-ALKBH8 Antibody

Target: ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALKBH8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALKBH8 Blocking Peptide, catalog no. 33R-5870, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALKBH8

Target: ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))

Alternative Name: ALKBH8 (ALKBH8 Products)

Synonyms: ABH8 antibody, 4930562C03Rik antibody, 8030431D03Rik antibody, 9430088N01Rik antibody, Abh8 antibody, alkB homolog 8, tRNA methyltransferase antibody, ALKBH8 antibody, Alkbh8 antibody

Background: ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA and catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA.

Molecular Weight: 27 kDa (MW of target protein)