TIA1 antibody (N-Term)
-
- Target See all TIA1 Antibodies
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TIA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TIA1 antibody was raised against the N terminal of TIA1
- Purification
- Affinity purified
- Immunogen
- TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
- Top Product
- Discover our top product TIA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TIA1 Blocking Peptide, catalog no. 33R-6040, is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
- Alternative Name
- TIA1 (TIA1 Products)
- Synonyms
- tia1 antibody, 2310050N03Rik antibody, AI256674 antibody, TIA-1 antibody, mTIA-1 antibody, WDM antibody, TIAL1 antibody, TIAR antibody, tia-1 antibody, nucleolysin TIA-1 isoform p40 antibody, hypothetical protein antibody, nucleolysin TIAR antibody, nucleolysin tia-1 antibody, nucleolysin TIA-1 antibody, cytotoxic granule-associated RNA binding protein 1 antibody, TIA1 cytotoxic granule associated RNA binding protein antibody, TIA1 cytotoxic granule-associated RNA binding protein antibody, TIA1 cytotoxic granule-associated RNA binding protein L homeolog antibody, PTRG_10065 antibody, PGTG_08590 antibody, LOC5568274 antibody, CpipJ_CPIJ013665 antibody, VDBG_07004 antibody, MGYG_03339 antibody, Tsp_15456 antibody, tia1 antibody, Tia1 antibody, TIA1 antibody, tia1.L antibody
- Background
- TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.
- Molecular Weight
- 43 kDa (MW of target protein)
-