CACNB4 antibody (C-Term)

Catalog No. ABIN633618

Product Details anti-CACNB4 Antibody

Target: CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNB4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNB4 antibody was raised against the C terminal of CACNB4

Purification: Affinity purified

Immunogen: CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNB4 Blocking Peptide, catalog no. 33R-4882, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNB4

Target: CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))

Alternative Name: CACNB4 (CACNB4 Products)

Synonyms: CAB4 antibody, CACNLB4 antibody, EA5 antibody, EIG9 antibody, EJM antibody, EJM4 antibody, EJM6 antibody, 3110038O15Rik antibody, Cchb4 antibody, lethargic antibody, lh antibody, CACNB4 antibody, cacnb4.2 antibody, calcium voltage-gated channel auxiliary subunit beta 4 antibody, calcium channel, voltage-dependent, beta 4 subunit antibody, calcium channel, voltage-dependent, beta 4a subunit antibody, CACNB4 antibody, Cacnb4 antibody, cacnb4.1 antibody, cacnb4 antibody, cacnb4a antibody

Background: CACNB4 is a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Skeletal Muscle Fiber Development