TOMM40L antibody

Catalog No. ABIN633628

Product Details anti-TOMM40L Antibody

Target: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOMM40L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOMM40L

Target: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Alternative Name: TOMM40L (TOMM40L Products)

Synonyms: RP11-297K8.10 antibody, TOMM40B antibody, Tom40B antibody, RGD1562006 antibody, Tomm40b antibody, zgc:85715 antibody, translocase of outer mitochondrial membrane 40 like antibody, translocase of outer mitochondrial membrane 40 homolog-like (yeast) antibody, translocase of outer mitochondrial membrane 40 homolog, like antibody, TOMM40L antibody, Tomm40l antibody, tomm40l antibody

Background: TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Molecular Weight: 34 kDa (MW of target protein)