CACNB3 antibody (N-Term)

Catalog No. ABIN633634

Product Details anti-CACNB3 Antibody

Target: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNB3 antibody was raised against the n terminal of CACNB3

Purification: Affinity purified

Immunogen: CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNB3 Blocking Peptide, catalog no. 33R-6623, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNB3

Target: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Alternative Name: CACNB3 (CACNB3 Products)

Synonyms: vgcc antibody, xo28 antibody, xo32 antibody, o32-a antibody, cacnlb3 antibody, VGCC antibody, CACNB3 antibody, CAB3 antibody, CACNLB3 antibody, Beta3 antibody, Cchb3 antibody, CACH3B antibody, cacnb3 antibody, Cacnb3 antibody, calcium channel, voltage-dependent, beta 3 subunit S homeolog antibody, calcium channel, voltage-dependent, beta 3 subunit L homeolog antibody, calcium voltage-gated channel auxiliary subunit beta 3 antibody, calcium channel, voltage-dependent, beta 3b antibody, calcium channel, voltage-dependent, beta 3 subunit antibody, calcium channel, voltage-dependent, beta 3a antibody, cacnb3.S antibody, cacnb3.L antibody, CACNB3 antibody, cacnb3b antibody, cacnb3 antibody, Cacnb3 antibody, cacnb3a antibody

Background: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction