CACNB4 antibody (Middle Region)
-
- Target See all CACNB4 Antibodies
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNB4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNB4 antibody was raised against the middle region of CACNB4
- Purification
- Affinity purified
- Immunogen
- CACNB4 antibody was raised using the middle region of CACNB4 corresponding to a region with amino acids GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP
- Top Product
- Discover our top product CACNB4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNB4 Blocking Peptide, catalog no. 33R-3649, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))
- Alternative Name
- CACNB4 (CACNB4 Products)
- Synonyms
- CAB4 antibody, CACNLB4 antibody, EA5 antibody, EIG9 antibody, EJM antibody, EJM4 antibody, EJM6 antibody, 3110038O15Rik antibody, Cchb4 antibody, lethargic antibody, lh antibody, CACNB4 antibody, cacnb4.2 antibody, calcium voltage-gated channel auxiliary subunit beta 4 antibody, calcium channel, voltage-dependent, beta 4 subunit antibody, calcium channel, voltage-dependent, beta 4a subunit antibody, CACNB4 antibody, Cacnb4 antibody, cacnb4.1 antibody, cacnb4 antibody, cacnb4a antibody
- Background
- CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Skeletal Muscle Fiber Development
-