CACNB1 antibody (Middle Region)

Catalog No. ABIN633645

Product Details anti-CACNB1 Antibody

Target: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNB1 antibody was raised against the middle region of CACNB1

Purification: Affinity purified

Immunogen: CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNB1 Blocking Peptide, catalog no. 33R-4715, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNB1

Target: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Alternative Name: CACNB1 (CACNB1 Products)

Synonyms: CACNB1 antibody, zgc:91982 antibody, CAB1 antibody, CACNLB1 antibody, CCHLB1 antibody, Cchb1 antibody, Cchlb1 antibody, calcium voltage-gated channel auxiliary subunit beta 1 antibody, calcium channel, voltage-dependent, beta 1 subunit antibody, calcium channel, voltage-dependent, beta 1 subunit S homeolog antibody, CACNB1 antibody, cacnb1 antibody, Cacnb1 antibody, cacnb1.S antibody

Background: CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Molecular Weight: 58 kDa (MW of target protein)