CACNA2D1 antibody (Middle Region)

Catalog No. ABIN633675

Product Details anti-CACNA2D1 Antibody

Target: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNA2D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNA2 D1 antibody was raised against the middle region of CACNA2 1

Purification: Affinity purified

Immunogen: CACNA2 D1 antibody was raised using the middle region of CACNA2 1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI

Application Details

Application Notes: WB: 0.12 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNA2D1 Blocking Peptide, catalog no. 33R-7178, is also available for use as a blocking control in assays to test for specificity of this CACNA2D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNA2D1

Target: CACNA2D1 (Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1))

Alternative Name: CACNA2D1 (CACNA2D1 Products)

Synonyms: CACNA2D1 antibody, DKFZp469K2211 antibody, CACNA2 antibody, CACNL2A antibody, CCHL2A antibody, Ca(v)alpha2delta1 antibody, Cacna2 antibody, Cchl2a antibody, CCHLA2 antibody, DHSCCA antibody, calcium voltage-gated channel auxiliary subunit alpha2delta 1 antibody, calcium channel, voltage-dependent, alpha 2/delta subunit 1 antibody, calcium channel, voltage-dependent, alpha2/delta subunit 1 antibody, CACNA2D1 antibody, cacna2d1 antibody, Cacna2d1 antibody

Background: CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.

Molecular Weight: 120 kDa (MW of target protein)