KCNA10 antibody (N-Term)
-
- Target See all KCNA10 Antibodies
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNA10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNA10 antibody was raised against the N terminal of KCNA10
- Purification
- Affinity purified
- Immunogen
- KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
- Top Product
- Discover our top product KCNA10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNA10 Blocking Peptide, catalog no. 33R-2212, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
- Alternative Name
- KCNA10 (KCNA10 Products)
- Synonyms
- cKv1.2 antibody, Kcn1 antibody, Kv1.8 antibody, Gm1962 antibody, Kcna8 antibody, potassium voltage-gated channel subfamily A member 10 antibody, potassium voltage-gated channel, shaker-related subfamily, member 10 antibody, KCNA10 antibody, Kcna10 antibody
- Background
- KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.
- Molecular Weight
- 58 kDa (MW of target protein)
-