Kv2.1/KCNB1 antibody (Middle Region)

Catalog No. ABIN633687

Product Details anti-Kv2.1/KCNB1 Antibody

Target: Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kv2.1/KCNB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNB1 antibody was raised against the middle region of KCNB1

Purification: Affinity purified

Immunogen: KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNB1 Blocking Peptide, catalog no. 33R-10132, is also available for use as a blocking control in assays to test for specificity of this KCNB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kv2.1/KCNB1

Target: Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))

Alternative Name: KCNB1 (KCNB1 Products)

Synonyms: KCNB1 antibody, Kcnb1 antibody, Kcr1-1 antibody, Kv2.1 antibody, Shab antibody, DRK1PC antibody, DRK1 antibody, KV2.1 antibody, h-DRK1 antibody, potassium voltage-gated channel subfamily B member 1 antibody, potassium voltage-gated channel, Shab-related subfamily, member 1 antibody, potassium channel, voltage gated Shab related subfamily B, member 1 antibody, potassium voltage gated channel, Shab-related subfamily, member 1 antibody, KCNB1 antibody, kcnb1 antibody, LOC100541632 antibody, Kcnb1 antibody

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).

Molecular Weight: 96 kDa (MW of target protein)

Pathways: Synaptic Membrane