KCNV1 antibody (N-Term)

Catalog No. ABIN633696

Product Details anti-KCNV1 Antibody

Target: KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNV1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNV1 antibody was raised against the N terminal of KCNV1

Purification: Affinity purified

Immunogen: KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNV1

Target: KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))

Alternative Name: KCNV1 (KCNV1 Products)

Synonyms: HNKA antibody, KCNB3 antibody, KV2.3 antibody, KV8.1 antibody, 2700023A03Rik antibody, vibe antibody, Kv8.1 antibody, potassium voltage-gated channel modifier subfamily V member 1 antibody, potassium channel, subfamily V, member 1 antibody, KCNV1 antibody, Kcnv1 antibody

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.

Molecular Weight: 56 kDa (MW of target protein)