P2RX7 antibody (Middle Region)

Catalog No. ABIN633697

Product Details anti-P2RX7 Antibody

Target: P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RX7 antibody was raised against the middle region of P2 X7

Purification: Affinity purified

Immunogen: P2 RX7 antibody was raised using the middle region of P2 X7 corresponding to a region with amino acids LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RX7 Blocking Peptide, catalog no. 33R-5361, is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX7

Target: P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))

Alternative Name: P2RX7 (P2RX7 Products)

Synonyms: p2xr7 antibody, P2RX7 antibody, P2X7 antibody, AI467586 antibody, P2X(7) antibody, P2X7R antibody, p2x7 antibody, purinergic receptor P2X 7 antibody, purinergic receptor P2X, ligand-gated ion channel, 7 antibody, P2X purinoceptor 7 antibody, P2RX7 antibody, p2rx7 antibody, LOC100458463 antibody, P2rx7 antibody

Background: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis