SCN8A antibody (Middle Region)

Catalog No. ABIN633702

Product Details anti-SCN8A Antibody

Target: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCN8A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCN8 A antibody was raised against the middle region of SCN8

Purification: Affinity purified

Immunogen: SCN8 A antibody was raised using the middle region of SCN8 corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCN8A Blocking Peptide, catalog no. 33R-2720, is also available for use as a blocking control in assays to test for specificity of this SCN8A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCN8A

Target: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Alternative Name: SCN8A (SCN8A Products)

Synonyms: CERIII antibody, CIAT antibody, EIEE13 antibody, MED antibody, NaCh6 antibody, Nav1.6 antibody, PN4 antibody, AI853486 antibody, C630029C19Rik antibody, dmu antibody, med antibody, mnd-2 antibody, mnd2 antibody, nmf2 antibody, nmf335 antibody, nmf58 antibody, nur14 antibody, seal antibody, sodium voltage-gated channel alpha subunit 8 antibody, sodium channel, voltage-gated, type VIII, alpha antibody, SCN8A antibody, Scn8a antibody

Background: Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.

Molecular Weight: 225 kDa (MW of target protein)

Pathways: Sensory Perception of Sound