KCNK12 antibody (Middle Region)

Catalog No. ABIN633703

Product Details anti-KCNK12 Antibody

Target: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK12 antibody was raised against the middle region of KCNK12

Purification: Affinity purified

Immunogen: KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK12

Target: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Alternative Name: KCNK12 (KCNK12 Products)

Synonyms: KCNK12 antibody, K2p12.1 antibody, THIK-2 antibody, THIK2 antibody, mntk1 antibody, potassium two pore domain channel subfamily K member 12 antibody, potassium channel, subfamily K, member 12 antibody, KCNK12 antibody, Kcnk12 antibody

Background: KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molecular Weight: 47 kDa (MW of target protein)