KCNJ4 antibody (Middle Region)
-
- Target See all KCNJ4 Antibodies
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNJ4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNJ4 antibody was raised against the middle region of KCNJ4
- Purification
- Affinity purified
- Immunogen
- KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
- Top Product
- Discover our top product KCNJ4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
- Alternative Name
- KCNJ4 (KCNJ4 Products)
- Synonyms
- KCNJ4 antibody, CKIR2.3 antibody, HIR antibody, HIRK2 antibody, HRK1 antibody, IRK-3 antibody, IRK3 antibody, Kir2.3 antibody, Kcnf2 antibody, MB-IRK3 antibody, Hirk2 antibody, potassium voltage-gated channel subfamily J member 4 antibody, potassium inwardly-rectifying channel, subfamily J, member 4 antibody, KCNJ4 antibody, Kcnj4 antibody
- Background
- KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.
- Molecular Weight
- 49 kDa (MW of target protein)
-