KCNA1 antibody (Middle Region)

Catalog No. ABIN633721

Product Details anti-KCNA1 Antibody

Target: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNA1 antibody was raised against the middle region of KCNA1

Purification: Affinity purified

Immunogen: KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNA1 Blocking Peptide, catalog no. 33R-4154, is also available for use as a blocking control in assays to test for specificity of this KCNA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNA1

Target: KCNA1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (KCNA1))

Alternative Name: KCNA1 (KCNA1 Products)

Synonyms: AEMK antibody, EA1 antibody, HBK1 antibody, HUK1 antibody, KV1.1 antibody, MBK1 antibody, MK1 antibody, RBK1 antibody, KCNA1 antibody, AI840627 antibody, Kca1-1 antibody, Kv1.1 antibody, Mk-1 antibody, Shak antibody, mceph antibody, Kcna antibody, Kcpvd antibody, potassium voltage-gated channel subfamily A member 1 antibody, potassium voltage-gated channel, shaker-related subfamily, member 1 antibody, fragile site, aphidicolin type, common, fra(12)(q24) antibody, KCNA1 antibody, Kcna1 antibody, FRA12E antibody

Background: KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Molecular Weight: 56 kDa (MW of target protein)