KCNJ9 antibody (Middle Region)
-
- Target See all KCNJ9 Antibodies
- KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNJ9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNJ9 antibody was raised against the middle region of KCNJ9
- Purification
- Affinity purified
- Immunogen
- KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR
- Top Product
- Discover our top product KCNJ9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNJ9 Blocking Peptide, catalog no. 33R-1778, is also available for use as a blocking control in assays to test for specificity of this KCNJ9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))
- Alternative Name
- KCNJ9 (KCNJ9 Products)
- Synonyms
- GIRK3 antibody, KIR3.3 antibody, 1700085N21Rik antibody, Girk3 antibody, Kir3.3 antibody, mbGIRK3 antibody, potassium voltage-gated channel subfamily J member 9 antibody, potassium inwardly-rectifying channel, subfamily J, member 9 antibody, KCNJ9 antibody, Kcnj9 antibody
- Background
- Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel.
- Molecular Weight
- 44 kDa (MW of target protein)
-