Kir2.2 antibody (Middle Region)
-
- Target See all Kir2.2 (KCNJ12) Antibodies
- Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Kir2.2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNJ12 antibody was raised against the middle region of KCNJ12
- Purification
- Affinity purified
- Immunogen
- KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
- Top Product
- Discover our top product KCNJ12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNJ12 Blocking Peptide, catalog no. 33R-4295, is also available for use as a blocking control in assays to test for specificity of this KCNJ12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kir2.2 (KCNJ12) (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 12 (KCNJ12))
- Alternative Name
- KCNJ12 (KCNJ12 Products)
- Synonyms
- IRK-2 antibody, IRK2 antibody, KCNJN1 antibody, Kir2.2 antibody, Kir2.2v antibody, hIRK antibody, hIRK1 antibody, hkir2.2x antibody, kcnj12x antibody, Kir2.1 antibody, IRK antibody, KIR2.2 antibody, MB-IRK2 antibody, potassium voltage-gated channel subfamily J member 12 antibody, ATP-sensitive inward rectifier potassium channel 12 antibody, potassium inwardly-rectifying channel, subfamily J, member 12 antibody, KCNJ12 antibody, LOC746628 antibody, Kcnj12 antibody
- Background
- KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Molecular Weight
- 49 kDa (MW of target protein)
-