CACNG6 antibody (N-Term)
-
- Target See all CACNG6 Antibodies
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNG6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNG6 antibody was raised against the N terminal of CACNG6
- Purification
- Affinity purified
- Immunogen
- CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA
- Top Product
- Discover our top product CACNG6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNG6 Blocking Peptide, catalog no. 33R-6240, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
- Alternative Name
- CACNG6 (CACNG6 Products)
- Synonyms
- CACNG6 antibody, cacng6 antibody, MGC122711 antibody, 2310033H20Rik antibody, AW050150 antibody, calcium voltage-gated channel auxiliary subunit gamma 6 antibody, calcium channel, voltage-dependent, gamma subunit 6 antibody, CACNG6 antibody, cacng6 antibody, Cacng6 antibody
- Background
- CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.
- Molecular Weight
- 28 kDa (MW of target protein)
-