KCNH2 antibody

Catalog No. ABIN633738

Product Details anti-KCNH2 Antibody

Target: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNH2 Blocking Peptide, catalog no. 33R-8732, is also available for use as a blocking control in assays to test for specificity of this KCNH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNH2

Target: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Alternative Name: KCNH2 (KCNH2 Products)

Synonyms: ERG1 antibody, HERG antibody, HERG1 antibody, Kv11.1 antibody, LQT2 antibody, SQT1 antibody, erg antibody, KCNH2 antibody, ERG antibody, gp-erg antibody, cerg antibody, derg antibody, erg1 antibody, AI326795 antibody, LQT antibody, Lqt2 antibody, M-erg antibody, Merg1 antibody, merg1a antibody, merg1b antibody, potassium voltage-gated channel subfamily H member 2 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 6a antibody, potassium voltage-gated channel, subfamily H (eag-related), member 2 antibody, potassium voltage-gated channel subfamily H member 6 antibody, KCNH2 antibody, kcnh6a antibody, Kcnh2 antibody, KCNH6 antibody

Background: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2).

Molecular Weight: 90 kDa (MW of target protein)