P2RX2 antibody (N-Term)

Catalog No. ABIN633739

Product Details anti-P2RX2 Antibody

Target: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RX2 antibody was raised against the N terminal of P2 X2

Purification: Affinity purified

Immunogen: P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RX2 Blocking Peptide, catalog no. 33R-10100, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX2

Target: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Alternative Name: P2RX2 (P2RX2 Products)

Synonyms: DFNA41 antibody, P2X2 antibody, P2X2a antibody, P2x2 antibody, p2xr2 antibody, P2RX2 antibody, purinergic receptor P2X 2 antibody, purinergic receptor P2X, ligand-gated ion channel, 2 antibody, P2RX2 antibody, P2rx2 antibody, p2rx2 antibody

Background: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity