P2RX4 antibody (N-Term)

Catalog No. ABIN633745

Product Details anti-P2RX4 Antibody

Target: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RX4 antibody was raised against the N terminal of P2 X4

Purification: Affinity purified

Immunogen: P2 RX4 antibody was raised using the N terminal of P2 X4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RX4 Blocking Peptide, catalog no. 33R-9751, is also available for use as a blocking control in assays to test for specificity of this P2RX4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX4

Target: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Alternative Name: P2RX4 (P2RX4 Products)

Synonyms: P2X4 antibody, P2X4R antibody, AI504491 antibody, AW555605 antibody, D5Ertd444e antibody, p2rx4 antibody, p2x4 antibody, wu:fi03f02 antibody, p2x4r antibody, p2rx4.2 antibody, p2xr4.2 antibody, purinergic receptor P2X 4 antibody, purinergic receptor P2X, ligand-gated ion channel 4 antibody, purinergic receptor P2X, ligand-gated ion channel, 4a antibody, purinergic receptor P2X, ligand gated ion channel, 4 L homeolog antibody, purinergic receptor P2X, ligand-gated ion channel, 4b antibody, P2RX4 antibody, P2rx4 antibody, p2rx4a antibody, p2rx4.L antibody, p2rx4b antibody

Background: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Synaptic Membrane