HTR3E antibody

Catalog No. ABIN633746

Product Details anti-HTR3E Antibody

Target: HTR3E (Serotonin Receptor 3E (HTR3E))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HTR3E antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Serotonin receptor 3 E antibody was raised using a synthetic peptide corresponding to a region with amino acids RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Serotonin receptor 3E Blocking Peptide , catalog no. 33R-8266, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HTR3E

Target: HTR3E (Serotonin Receptor 3E (HTR3E))

Alternative Name: Serotonin Receptor 3E (HTR3E Products)

Synonyms: 5-HT3-E antibody, 5-HT3E antibody, 5-HT3c1 antibody, 5-hydroxytryptamine receptor 3E antibody, HTR3E antibody

Background: HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.

Molecular Weight: 53 kDa (MW of target protein)