KCNH3 antibody

Catalog No. ABIN633747

This anti-KCNH3 antibody is a Rabbit Polyclonal antibody detecting KCNH3 in WB. Suitable for Human.

Quick Overview for KCNH3 antibody (ABIN633747)

Target: KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNH3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNH3 Antibody

Purification: Affinity purified

Immunogen: KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNH3 Blocking Peptide, (ABIN5614271), is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNH3

Target: KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))

Alternative Name: KCNH3

Background: This gene encodes a pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly

Molecular Weight: 117 kDa (MW of target protein)