TRPC6 antibody (N-Term)

Catalog No. ABIN633748

Product Details anti-TRPC6 Antibody

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPC6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRPC6 antibody was raised against the N terminal of TRPC6

Purification: Affinity purified

Immunogen: TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPC6 Blocking Peptide, catalog no. 33R-6482, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPC6

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Alternative Name: TRPC6 (TRPC6 Products)

Synonyms: FSGS2 antibody, TRP6 antibody, AV025995 antibody, LLHWJM002 antibody, LLHWJM003 antibody, LLHWJM004 antibody, TRP-6 antibody, Trrp6 antibody, mtrp6 antibody, trp6 antibody, bZ1P14.9 antibody, si:rp71-1p14.9 antibody, trpc6 antibody, transient receptor potential cation channel subfamily C member 6 antibody, transient receptor potential cation channel, subfamily C, member 6 antibody, transient receptor potential cation channel, subfamily C, member 6a antibody, TRPC6 antibody, Trpc6 antibody, trpc6a antibody, trpc6 antibody

Background: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Molecular Weight: 106 kDa (MW of target protein)