KCND3 antibody (Middle Region)

Catalog No. ABIN633759

Product Details anti-KCND3 Antibody

Target: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCND3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCND3 antibody was raised against the middle region of KCND3

Purification: Affinity purified

Immunogen: KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCND3 Blocking Peptide, catalog no. 33R-9423, is also available for use as a blocking control in assays to test for specificity of this KCND3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCND3

Target: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Alternative Name: KCND3 (KCND3 Products)

Synonyms: KCND3 antibody, zgc:55306 antibody, wu:fi06g01 antibody, kv4.3 antibody, K(v)4.3 antibody, AW045978 antibody, Kncd3 antibody, Kv4.3 antibody, KCND3L antibody, KCND3S antibody, KSHIVB antibody, KV4.3 antibody, kcnd3-A antibody, xKv4.3 antibody, potassium voltage-gated channel subfamily D member 3 antibody, potassium voltage-gated channel, Shal-related subfamily, member 3 antibody, potassium channel, voltage gated Shal related subfamily D, member 3 antibody, potassium voltage-gated channel, Shal-related family, member 3 antibody, potassium channel, voltage gated Shal related subfamily D, member 3 L homeolog antibody, KCND3 antibody, kcnd3 antibody, Kcnd3 antibody, kcnd3.L antibody

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Molecular Weight: 71 kDa (MW of target protein)