GABRB2 antibody

Catalog No. ABIN633763

Product Details anti-GABRB2 Antibody

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reactivity: Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRB2 Blocking Peptide, catalog no. 33R-3806, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRB2

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Alternative Name: GABRB2 (GABRB2 Products)

Synonyms: GABRB2 antibody, GARB2 antibody, fj59e04 antibody, gabaabeta2 antibody, wu:fj59e04 antibody, zgc:136311 antibody, GABARB antibody, AI834970 antibody, C030002O17Rik antibody, C030021G16Rik antibody, Gabrab2 antibody, Gabrb-2 antibody, gamma-aminobutyric acid type A receptor beta2 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, beta 2 antibody, gamma-aminobutyric acid type A receptor beta 2 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 antibody, GABRB2 antibody, gabrb2 antibody, Gabrb2 antibody

Background: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane