CHRFAM7A antibody (Middle Region)
-
- Target See all CHRFAM7A Antibodies
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRFAM7A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHRFAM7 A antibody was raised against the middle region of CHRFAM7
- Purification
- Affinity purified
- Immunogen
- CHRFAM7 A antibody was raised using the middle region of CHRFAM7 corresponding to a region with amino acids QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
- Top Product
- Discover our top product CHRFAM7A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRFAM7A Blocking Peptide, catalog no. 33R-7718, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRFAM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRFAM7A (CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A))
- Alternative Name
- CHRFAM7A (CHRFAM7A Products)
- Synonyms
- CHRNA7 antibody, CHRNA7-DR1 antibody, D-10 antibody, CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion antibody, CHRFAM7A antibody
- Background
- The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A. The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A).
- Molecular Weight
- 35 kDa (MW of target protein)
-