SCN1B antibody (Middle Region)

Catalog No. ABIN633779

Product Details anti-SCN1B Antibody

Target: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCN1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCN1 B antibody was raised against the middle region of SCN1

Purification: Affinity purified

Immunogen: SCN1 B antibody was raised using the middle region of SCN1 corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCN1B Blocking Peptide, catalog no. 33R-6928, is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCN1B

Target: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Alternative Name: SCN1B (SCN1B Products)

Synonyms: GEFSP1 antibody, sodium channel, voltage-gated, type I, beta antibody, sodium voltage-gated channel beta subunit 1 antibody, Scn1b antibody, SCN1B antibody

Background: Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.

Molecular Weight: 25 kDa (MW of target protein)