SCN3B antibody (N-Term)

Catalog No. ABIN633798

Product Details anti-SCN3B Antibody

Target: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Binding Specificity: N-Term

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCN3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCN3 B antibody was raised against the N terminal of SCN3

Purification: Affinity purified

Immunogen: SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCN3B Blocking Peptide, catalog no. 33R-8090, is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCN3B

Target: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Alternative Name: SCN3B (SCN3B Products)

Synonyms: 1110001K16Rik antibody, 4833414B02Rik antibody, Scnb3 antibody, HSA243396 antibody, SCNB3 antibody, sodium voltage-gated channel beta subunit 3 antibody, sodium channel, voltage-gated, type III, beta antibody, SCN3B antibody, Scn3b antibody

Background: SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.

Molecular Weight: 24 kDa (MW of target protein)