Nestin antibody (Middle Region)

Catalog No. ABIN633803

Product Details anti-Nestin Antibody

Target: Nestin (NES)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nestin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Nestin antibody was raised against the middle region of NES

Purification: Affinity purified

Immunogen: Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nestin Blocking Peptide, catalog no. 33R-5261, is also available for use as a blocking control in assays to test for specificity of this Nestin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nestin

Target: Nestin (NES)

Alternative Name: Nestin (NES Products)

Synonyms: paranemin antibody, NES antibody, AA166324 antibody, C78523 antibody, ESTM46 antibody, nestin antibody, nestin S homeolog antibody, NES antibody, nes.S antibody, Nes antibody, nes antibody

Background: Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.

Molecular Weight: 177 kDa (MW of target protein)