Nestin antibody (Middle Region)
-
- Target See all Nestin (NES) Antibodies
- Nestin (NES)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nestin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Nestin antibody was raised against the middle region of NES
- Purification
- Affinity purified
- Immunogen
- Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
- Top Product
- Discover our top product NES Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nestin Blocking Peptide, catalog no. 33R-5261, is also available for use as a blocking control in assays to test for specificity of this Nestin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nestin (NES)
- Alternative Name
- Nestin (NES Products)
- Synonyms
- paranemin antibody, NES antibody, AA166324 antibody, C78523 antibody, ESTM46 antibody, nestin antibody, nestin S homeolog antibody, NES antibody, nes.S antibody, Nes antibody, nes antibody
- Background
- Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.
- Molecular Weight
- 177 kDa (MW of target protein)
-