DPYSL2 antibody (Middle Region)
-
- Target See all DPYSL2 Antibodies
- DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPYSL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPYSL2 antibody was raised against the middle region of DPYSL2
- Purification
- Affinity purified
- Immunogen
- DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR
- Top Product
- Discover our top product DPYSL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPYSL2 Blocking Peptide, catalog no. 33R-6719, is also available for use as a blocking control in assays to test for specificity of this DPYSL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))
- Alternative Name
- DPYSL2 (DPYSL2 Products)
- Synonyms
- CRMP-2 antibody, CRMP2 antibody, DHPRP2 antibody, DRP-2 antibody, DRP2 antibody, N2A3 antibody, ULIP-2 antibody, ULIP2 antibody, TOAD-64 antibody, crmp2 antibody, dhprp2 antibody, drp-2 antibody, drp2 antibody, unc-33 antibody, unc33 antibody, dpysl2 antibody, CRMP 2 antibody, PCRMP 2 antibody, PCRMP-2 antibody, PCRMP2 antibody, PfCRMP 2 antibody, PfCRMP-2 antibody, AI851130 antibody, Crmp2 antibody, Musunc33 antibody, Ulip2 antibody, CRMP2A antibody, dihydropyrimidinase like 2 antibody, dihydropyrimidinase-like 2 antibody, dihydropyrimidinase like 2 L homeolog antibody, dihydropyrimidinase-like 2b antibody, cysteine repeat modular protein 2, putative antibody, DPYSL2 antibody, dpysl2.L antibody, dpysl2b antibody, PfCRMP2 antibody, dpysl2 antibody, Dpysl2 antibody
- Background
- DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. The protein plays a role in axon guidance, neuronal growth cone collapse and cell migration.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-