GNAO1 antibody (Middle Region)
-
- Target See all GNAO1 Antibodies
- GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNAO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GNAO1 antibody was raised against the middle region of Gnao1
- Purification
- Affinity purified
- Immunogen
- GNAO1 antibody was raised using the middle region of Gnao1 corresponding to a region with amino acids CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
- Top Product
- Discover our top product GNAO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNAO1 Blocking Peptide, catalog no. 33R-1672, is also available for use as a blocking control in assays to test for specificity of this GNAO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAO1 (Guanine Nucleotide Binding Protein (G Protein), alpha Activating Activity Polypeptide O (GNAO1))
- Alternative Name
- GNAO1 (GNAO1 Products)
- Synonyms
- G-ALPHA-o antibody, GNAO antibody, AW050213 antibody, Galphao antibody, Gnao antibody, alphaO antibody, gnao1 antibody, wu:fq26h05 antibody, zgc:73315 antibody, RATBPGTPC antibody, XGalpha01 antibody, gnao1-A antibody, zgc:73153 antibody, G protein subunit alpha o1 antibody, guanine nucleotide binding protein, alpha O antibody, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a antibody, G protein subunit alpha o1 L homeolog antibody, Guanine nucleotide-binding protein G(o) subunit alpha antibody, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b antibody, GNAO1 antibody, Gnao1 antibody, gnao1a antibody, gnao1.L antibody, goa-1 antibody, gnao1b antibody
- Background
- Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-