ST8SIA4 antibody (Middle Region)

Catalog No. ABIN633811

Product Details anti-ST8SIA4 Antibody

Target: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST8SIA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST8 SIA4 antibody was raised against the middle region of ST8 IA4

Purification: Affinity purified

Immunogen: ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST8SIA4

Target: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Alternative Name: ST8SIA4 (ST8SIA4 Products)

Synonyms: PST antibody, PST-1 antibody, SIAT8-D antibody, ST8SiaIV antibody, Siat8d antibody, PST1 antibody, SIAT8D antibody, ST8SIA-IV antibody, ST8Sia-IV antibody, pst antibody, siat 8D antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antibody, St8sia4 antibody, ST8SIA4 antibody, st8sia4 antibody

Background: ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.

Molecular Weight: 41 kDa (MW of target protein)