HEY1 antibody (N-Term)

Catalog No. ABIN633815

Product Details anti-HEY1 Antibody

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HEY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HEY1 antibody was raised against the N terminal of HEY1

Purification: Affinity purified

Immunogen: HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HEY1 Blocking Peptide, catalog no. 33R-1335, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HEY1

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Alternative Name: HEY1 (HEY1 Products)

Synonyms: BHLHb31 antibody, CHF2 antibody, HERP2 antibody, HESR1 antibody, HRT-1 antibody, OAF1 antibody, AI316788 antibody, AI414254 antibody, HRT1 antibody, Herp2 antibody, Hesr1 antibody, bHLHb31 antibody, hesr-1 antibody, id:ibd1292 antibody, zgc:110572 antibody, bc8 antibody, chf2 antibody, herp2 antibody, hesr1 antibody, hrt1 antibody, oaf1 antibody, xbc8 antibody, hes related family bHLH transcription factor with YRPW motif 1 antibody, hairy/enhancer-of-split related with YRPW motif 1 antibody, hes-related family bHLH transcription factor with YRPW motif 1 antibody, hes related family bHLH transcription factor with YRPW motif 1 S homeolog antibody, HEY1 antibody, Hey1 antibody, hey1 antibody, hey1.S antibody

Background: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Tube Formation