PRR5 antibody

Catalog No. ABIN633818

Product Details anti-PRR5 Antibody

Target: PRR5 (Proline Rich 5 (Renal) (PRR5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRR5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRR5 Blocking Peptide, catalog no. 33R-3387, is also available for use as a blocking control in assays to test for specificity of this PRR5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRR5

Target: PRR5 (Proline Rich 5 (Renal) (PRR5))

Alternative Name: PRR5 (PRR5 Products)

Synonyms: AU043908 antibody, Arhgap8 antibody, C030017C09Rik antibody, C78947 antibody, Protor-1 antibody, Protor1 antibody, FLJ20185k antibody, PP610 antibody, PROTOR-1 antibody, PROTOR1 antibody, pp610 antibody, protor1 antibody, protor2 antibody, proline rich 5 (renal) antibody, proline rich 5 antibody, proline rich 5 L homeolog antibody, Prr5 antibody, PRR5 antibody, prr5.L antibody

Background: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling