CRMP1 antibody (C-Term)

Catalog No. ABIN633822

Product Details anti-CRMP1 Antibody

Target: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRMP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRMP1 antibody was raised against the C terminal of CRMP1

Purification: Affinity purified

Immunogen: CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRMP1 Blocking Peptide, catalog no. 33R-8838, is also available for use as a blocking control in assays to test for specificity of this CRMP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRMP1

Target: CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))

Alternative Name: CRMP1 (CRMP1 Products)

Synonyms: CRMP1 antibody, crmp1 antibody, MGC145930 antibody, CRMP 1 antibody, CRMP-1 antibody, PCRMP 1 antibody, PCRMP-1 antibody, PCRMP1 antibody, PfCRMP-1 antibody, DPYSL1 antibody, DRP-1 antibody, DRP1 antibody, ULIP-3 antibody, Dpysl1 antibody, Ulip3 antibody, CRMP1B antibody, collapsin response mediator protein 1 antibody, dihydropyrimidinase-related protein 1 antibody, cysteine repeat modular protein 1, putative antibody, collapsin response mediator protein 1 L homeolog antibody, CRMP1 antibody, crmp1 antibody, LOC100350067 antibody, PfCRMP1 antibody, Crmp1 antibody, crmp1.L antibody

Background: CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.

Molecular Weight: 62 kDa (MW of target protein)