TRAPPC4 antibody (Middle Region)

Catalog No. ABIN633833

Product Details anti-TRAPPC4 Antibody

Target: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAPPC4 antibody was raised against the middle region of TRAPPC4

Purification: Affinity purified

Immunogen: TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC4 Blocking Peptide, catalog no. 33R-2512, is also available for use as a blocking control in assays to test for specificity of this TRAPPC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC4

Target: TRAPPC4 (Trafficking Protein Particle Complex 4 (TRAPPC4))

Alternative Name: TRAPPC4 (TRAPPC4 Products)

Synonyms: HSPC172 antibody, PTD009 antibody, SBDN antibody, SYNBINDIN antibody, TRS23 antibody, 1500017G03Rik antibody, AI303617 antibody, Sbd antibody, Sbdn antibody, Sdcbp2 antibody, zgc:73260 antibody, TRAPPC4 antibody, MGC131237 antibody, sbdn antibody, trs23 antibody, ptd009 antibody, cgi-104 antibody, hspc172 antibody, trafficking protein particle complex 4 antibody, trafficking protein particle complex 4 S homeolog antibody, TRAPPC4 antibody, Trappc4 antibody, trappc4 antibody, trappc4.S antibody

Background: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molecular Weight: 24 kDa (MW of target protein)