DNASE2B antibody (Middle Region)

Catalog No. ABIN633853

Product Details anti-DNASE2B Antibody

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNASE2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DNASE2 B antibody was raised against the middle region of DNASE2

Purification: Affinity purified

Immunogen: DNASE2 B antibody was raised using the middle region of DNASE2 corresponding to a region with amino acids QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNASE2B Blocking Peptide, catalog no. 33R-7604, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNASE2B

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Alternative Name: DNASE2B (DNASE2B Products)

Synonyms: DNASE2 antibody, deoxyribonuclease-2-beta antibody, DLAD antibody, DNASE2B antibody, dnase2b antibody, AI526873 antibody, Dlad antibody, DnaseIIb antibody, UOX antibody, deoxyribonuclease 2 beta antibody, deoxyribonuclease II beta antibody, DNASE2B antibody, dnase2b antibody, Dnase2b antibody

Background: DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.

Molecular Weight: 18 kDa (MW of target protein)