WNT3A antibody (N-Term)
-
- Target See all WNT3A Antibodies
- WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT3 A antibody was raised against the N terminal of WNT3
- Purification
- Affinity purified
- Immunogen
- WNT3 A antibody was raised using the N terminal of WNT3 corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP
- Top Product
- Discover our top product WNT3A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT3A Blocking Peptide, catalog no. 33R-5711, is also available for use as a blocking control in assays to test for specificity of this WNT3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))
- Alternative Name
- WNT3A (WNT3A Products)
- Synonyms
- WNT3A antibody, Wnt-3a antibody, vt antibody, Zwnt[a] antibody, wnt3 antibody, wnt3 l antibody, wnt3l antibody, wnt[a] antibody, Xwnt-3a antibody, wnt-3a antibody, wnt3a-A antibody, xwnt3a antibody, WNT-3A antibody, WNT3 antibody, wingless-type MMTV integration site family, member 3A antibody, Wnt family member 3A antibody, wingless-type MMTV integration site family member 3A L homeolog antibody, WNT3A antibody, Wnt3a antibody, wnt3a antibody, wnt3a.L antibody
- Background
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- WNT Signaling, Regulation of Muscle Cell Differentiation, Regulation of Cell Size, Positive Regulation of Endopeptidase Activity
-