IGFBP4 antibody (Middle Region)

Catalog No. ABIN633882

Product Details anti-IGFBP4 Antibody

Target: IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGFBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGFBP4 antibody was raised against the middle region of IGFBP4

Purification: Affinity purified

Immunogen: IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGFBP4 Blocking Peptide, catalog no. 33R-7813, is also available for use as a blocking control in assays to test for specificity of this IGFBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGFBP4

Target: IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))

Alternative Name: IGFBP4 (IGFBP4 Products)

Synonyms: IGFBP4 antibody, igfbp4 antibody, BP-4 antibody, HT29-IGFBP antibody, IBP4 antibody, IGFBP-4 antibody, AI875747 antibody, Deb2 antibody, IGF-BP4 antibody, IBP-4 antibody, insulin like growth factor binding protein 4 antibody, insulin-like growth factor-binding protein 4 antibody, insulin-like growth factor binding protein 4 antibody, IGFBP4 antibody, LOC100136305 antibody, LOC100194498 antibody, igfbp4 antibody, Igfbp4 antibody

Background: IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: WNT Signaling, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process