NDUFS3 antibody (Middle Region)
-
- Target See all NDUFS3 Antibodies
- NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDUFS3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NDUFS3 antibody was raised against the middle region of NDUFS3
- Purification
- Affinity purified
- Immunogen
- NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
- Top Product
- Discover our top product NDUFS3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDUFS3 Blocking Peptide, catalog no. 33R-2797, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))
- Alternative Name
- NDUFS3 (NDUFS3 Products)
- Synonyms
- CI-30 antibody, 0610010M09Rik antibody, CI-30kD antibody, GB15355 antibody, zgc:112520 antibody, NADH:ubiquinone oxidoreductase core subunit S3 antibody, NADH dehydrogenase (ubiquinone) Fe-S protein 3 antibody, NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial antibody, NADH:ubiquinone oxidoreductase core subunit S3 S homeolog antibody, NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase) antibody, NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase) antibody, NDUFS3 antibody, Ndufs3 antibody, ndufs3 antibody, LOC411411 antibody, ndufs3.S antibody, LOC100228726 antibody
- Background
- This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-