GFRA2 antibody (C-Term)

Catalog No. ABIN633905

Product Details anti-GFRA2 Antibody

Target: GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GFRA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GFRA2 antibody was raised against the C terminal of GFRA2

Purification: Affinity purified

Immunogen: GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GFRA2 Blocking Peptide, catalog no. 33R-6924, is also available for use as a blocking control in assays to test for specificity of this GFRA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFRA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GFRA2

Target: GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))

Alternative Name: GFRA2 (GFRA2 Products)

Synonyms: GDNFRB antibody, NRTNR-ALPHA antibody, NTNRA antibody, RETL2 antibody, TRNR2 antibody, Retl2 antibody, NTNRALPHA antibody, ntnra antibody, retl2 antibody, trnr2 antibody, gdnfrb antibody, nrtnr-alpha antibody, gfra2 antibody, GDNF family receptor alpha 2 antibody, glial cell line derived neurotrophic factor family receptor alpha 2 antibody, GDNF family receptor alpha 2a antibody, GFRA2 antibody, Gfra2 antibody, gfra2 antibody, gfra2a antibody

Background: Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.

Molecular Weight: 47 kDa (MW of target protein)